PDB entry 3ntv

View 3ntv on RCSB PDB site
Description: Crystal structure of a putative caffeoyl-CoA O-methyltransferase from Staphylococcus aureus
Class: transferase
Keywords: rossmann fold, putative methyltransferase, TRANSFERASE
Deposited on 2010-07-05, released 2011-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.178
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MW1564 protein
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: MW1564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ntva_
  • Chain 'B':
    Compound: MW1564 protein
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: MW1564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ntvb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ntvA (A:)
    mgsshhhhhhssglvprgshmddlnkkylidlhqhqnssievlrefaevnevpivdrltl
    dlikqlirmnnvknileigtaigyssmqfasisddihvttiernetmiqyakqnlatyhf
    enqvriiegnaleqfenvndkvydmifidaakaqskkffeiytpllkhqglvitdnvlyh
    gfvsdigivrsrnvrqmvkkvqdynewlikqpgyttnflniddglaisikge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ntvA (A:)
    mddlnkkylidlhqhqnssievlrefaevnevpivdrltldlikqlirmnnvknileigt
    aigyssmqfasisddihvttiernetmiqyakqnlatyhfenqvriiegnaleqfenvnd
    kvydmifidaakaqskkffeiytpllkhqglvitdnvlyhgfvsdigivrsrnvrqmvkk
    vqdynewlikqpgyttnflniddglaisikg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ntvB (B:)
    mgsshhhhhhssglvprgshmddlnkkylidlhqhqnssievlrefaevnevpivdrltl
    dlikqlirmnnvknileigtaigyssmqfasisddihvttiernetmiqyakqnlatyhf
    enqvriiegnaleqfenvndkvydmifidaakaqskkffeiytpllkhqglvitdnvlyh
    gfvsdigivrsrnvrqmvkkvqdynewlikqpgyttnflniddglaisikge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ntvB (B:)
    dlnkkylidlhqhqnssievlrefaevnevpivdrltldlikqlirmnnvknileigtai
    gyssmqfasisddihvttiernetmiqyakqnlatyhfenqvriiegnaleqfenvndkv
    ydmifidaakaqskkffeiytpllkhqglvitdnvlyhgfvsdigivrsrnvrqmvkkvq
    dynewlikqpgyttnflniddglaisikg