PDB entry 3ntu

View 3ntu on RCSB PDB site
Description: RADA RECOMBINASE D302K MUTANT IN COMPLEX with AMP-PNP
Class: recombination
Keywords: ATPase, recombinase, ATP complex, active conformation, reca, rad51, dmc1, rada, recombination
Deposited on 2010-07-05, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:523842]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (0-318)
      • engineered mutation (0)
      • engineered mutation (298)
    Domains in SCOPe 2.07: d3ntua1, d3ntua2
  • Heterogens: ANP, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ntuA (A:)
    gltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlg
    fksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlq
    npeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvaray
    nsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnk
    ladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvaklyks
    phlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ntuA (A:)
    gltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlg
    fksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlq
    npeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvaray
    nsdmqmlfaekiedliqegnniklvvidsltstfrneytgklaerqqklgrhmatlnkla
    dlfncvvlvtnqvsakaeqaigghivghaatfrffvrkgkgdkrvaklyksphlpdaeai
    fritekgiqd