PDB entry 3ntr

View 3ntr on RCSB PDB site
Description: crystal structure of k97v mutant of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nad and inositol
Deposited on 2010-07-05, released 2010-09-15
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU39700, E83G, idh, iolG, NP_391849.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26935 (0-End)
      • engineered mutation (96)
  • Chain 'B':
    Compound: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU39700, E83G, idh, iolG, NP_391849.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26935 (0-End)
      • engineered mutation (96)
  • Heterogens: NAD, INS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ntrA (A:)
    mslrigvigtgaigkehinritnklsgaeivavtdvnqeaaqkvveqyqlnatvypndds
    lladenvdavlvtswgpahessvlkaikaqkyvfcevplattaegcmriveeeikvgkrl
    vqvgfmrrydsgyvqlkealdnhvigeplmihcahrnptvgdnyttdmavvdtlvheidv
    lhwlvnddyesvqviypkksknalphlkdpqivvietkggivinaeiyvnckygydiqce
    ivgedgiiklpepssislrkegrfstdilmdwqrrfvaaydveiqdfidsiqkkgevsgp
    tawdgyiaavttdacvkaqesgqkekvelkekpefyqsfttvqn
    

    Sequence, based on observed residues (ATOM records):
    >3ntrA (A:)
    mslrigvigtgaigkehinritnklsgaeivavtdvnqeaaqkvveqyqlnatvypndds
    lladenvdavlvtswgpahessvlkaikaqkyvfcevplattaegcmriveeeikvgkrl
    vqvgfmrrydsgyvqlkealdnhvigeplmihcahrnptvgdnyttdmavvdtlvheidv
    lhwlvnddyesvqviypkksknalphlkdpqivvietkggivinaeiyvnckygydiqce
    ivgedgiiklpepssislrkegrfstdilmdwqrrfvaaydveiqdfidsiqkkgevsgp
    tawdgyiaavttdacvkaqesgqkekvelkekpefyq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ntrB (B:)
    mslrigvigtgaigkehinritnklsgaeivavtdvnqeaaqkvveqyqlnatvypndds
    lladenvdavlvtswgpahessvlkaikaqkyvfcevplattaegcmriveeeikvgkrl
    vqvgfmrrydsgyvqlkealdnhvigeplmihcahrnptvgdnyttdmavvdtlvheidv
    lhwlvnddyesvqviypkksknalphlkdpqivvietkggivinaeiyvnckygydiqce
    ivgedgiiklpepssislrkegrfstdilmdwqrrfvaaydveiqdfidsiqkkgevsgp
    tawdgyiaavttdacvkaqesgqkekvelkekpefyqsfttvqn
    

    Sequence, based on observed residues (ATOM records):
    >3ntrB (B:)
    mslrigvigtgaigkehinritnklsgaeivavtdvnqeaaqkvveqyqlnatvypndds
    lladenvdavlvtswgpahessvlkaikaqkyvfcevplattaegcmriveeeikvgkrl
    vqvgfmrrydsgyvqlkealdnhvigeplmihcahrnptvgdnyttdmavvdtlvheidv
    lhwlvnddyesvqviypkksknalphlkdpqivvietkggivinaeiyvnckygydiqce
    ivgedgiiklpepssislrkegrfstdilmdwqrrfvaaydveiqdfidsiqkkgevsgp
    tawdgyiaavttdacvkaqesgqkekvelkekpefyq