PDB entry 3ntp

View 3ntp on RCSB PDB site
Description: Human Pin1 complexed with reduced amide inhibitor
Class: Isomerase/Isomerase inhibitor
Keywords: prolyl isomerase, phosphorylation regulation, Isomerase-Isomerase inhibitor complex
Deposited on 2010-07-05, released 2012-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.233
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-166)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d3ntpa1, d3ntpa2
  • Heterogens: RZD, PE8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ntpA (A:)
    gshgmadeeklppgwekamsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvr
    cshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssa
    kargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ntpA (A:)
    klppgwekamsrssgrvyyfnhitnasqwerpsgeparvrcshllvkhsqsrrpsswrqe
    kitrtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqmqkpfed
    asfalrtgemsgpvftdsgihiilrte