PDB entry 3ntn

View 3ntn on RCSB PDB site
Description: Crystal Structure of UspA1 head and neck domain from Moraxella catarrhalis
Deposited on 2010-07-05, released 2011-07-06
The last revision was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UspA1
    Species: Moraxella catarrhalis [TaxId:480]
    Gene: UspA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XD56 (Start-213)
      • expression tag (214-219)
  • Chain 'B':
    Compound: UspA1
    Species: Moraxella catarrhalis [TaxId:480]
    Gene: UspA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XD56 (0-213)
      • expression tag (214-219)
  • Chain 'C':
    Compound: UspA1
    Species: Moraxella catarrhalis [TaxId:480]
    Gene: UspA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XD56 (Start-213)
      • expression tag (214-219)
  • Heterogens: SO4, CL, NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ntnA (A:)
    yneatienstvggggynqakgrnstvaggynneatgtdstiaggrknqatgkgsfaagid
    nkanadnavalgnkntiegensvaigsnntvkkgqqnvfilgsntdttnaqngsvllghn
    tagkaativnsaevgglsltgfagasktgngtvsvgkkgkerqivhvgageisdtstdav
    ngsqlhalatvvaqnkadikdlddevgllgeeinkhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3ntnA (A:)
    enstvggggynqakgrnstvaggynneatgtdstiaggrknqatgkgsfaagidnkanad
    navalgnkntiegensvaigsnntvkkgqqnvfilgsntdttnaqngsvllghntagkaa
    tivnsaevgglsltgfagasngtvsvgkkgkerqivhvgageisdtstdavngsqlhala
    tvvaqnkadikdlddevgllgeeinkhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ntnB (B:)
    yneatienstvggggynqakgrnstvaggynneatgtdstiaggrknqatgkgsfaagid
    nkanadnavalgnkntiegensvaigsnntvkkgqqnvfilgsntdttnaqngsvllghn
    tagkaativnsaevgglsltgfagasktgngtvsvgkkgkerqivhvgageisdtstdav
    ngsqlhalatvvaqnkadikdlddevgllgeeinkhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3ntnB (B:)
    yneatienstvggggynqakgrnstvaggynneatgtdstiaggrknqatgkgsfaagid
    nkanadnavalgnkntiegensvaigsnntvkkgqqnvfilgsntdttnaqngsvllghn
    tagkaativnsaevgglsltgfagasngtvsvgkkgkerqivhvgageisdtstdavngs
    qlhalatvvaqnkadikdlddevgllgeeinkhhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3ntnC (C:)
    yneatienstvggggynqakgrnstvaggynneatgtdstiaggrknqatgkgsfaagid
    nkanadnavalgnkntiegensvaigsnntvkkgqqnvfilgsntdttnaqngsvllghn
    tagkaativnsaevgglsltgfagasktgngtvsvgkkgkerqivhvgageisdtstdav
    ngsqlhalatvvaqnkadikdlddevgllgeeinkhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3ntnC (C:)
    enstvggggynqakgrnstvaggynneatgtdstiaggrknqatgkgsfaagidnkanad
    navalgnkntiegensvaigsnntvkkgqqnvfilgsntdttnaqngsvllghntagkaa
    tivnsaevgglsltgfagasngtvsvgkkgkerqivhvgageisdtstdavngsqlhala
    tvvaqnkadikdlddevgllgeeinkhhhhh