PDB entry 3ntk

View 3ntk on RCSB PDB site
Description: Crystal structure of Tudor
Deposited on 2010-07-05, released 2010-09-15
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maternal protein tudor
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: tud
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Maternal protein tudor
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: tud
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ntkA (A:)
    aelhncvvvqfdgpmsfyvqmesdvpaleqmtdklldaeqdlpafsdlkegalcvaqfpe
    devfyraqirkvlddgkcevhfidfgnnavtqqfrqlpeelakparysrhceldastisk
    cdaallqsfidtrfsetfqveilatkgtgthvvrlfyqskniseklqec
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ntkB (B:)
    aelhncvvvqfdgpmsfyvqmesdvpaleqmtdklldaeqdlpafsdlkegalcvaqfpe
    devfyraqirkvlddgkcevhfidfgnnavtqqfrqlpeelakparysrhceldastisk
    cdaallqsfidtrfsetfqveilatkgtgthvvrlfyqskniseklqec
    

    Sequence, based on observed residues (ATOM records):
    >3ntkB (B:)
    aelhncvvvqfdgpmsfyvqmesdvpaleqmtdklldaeqdlpafsdlkegalcvaqfpe
    devfyraqirkvlddgkcevhfidfgnnavtqqfrqlpeelakparysrhceldastisk
    cllqsfidtrfsetfqveilatkgtgthvvrlfyqskniseklqec