PDB entry 3nti

View 3nti on RCSB PDB site
Description: Crystal structure of Tudor and Aubergine [R15(me2s)] complex
Deposited on 2010-07-05, released 2010-09-15
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maternal protein tudor
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: tud
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: peptide from Aubergine
    Species: DROSOPHILA MELANOGASTER, synthetic [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ntiA (A:)
    leaelhncvvvqfdgpmsfyvqmesdvpaleqmtdklldaeqdlpafsdlkegalcvaqf
    pedevfyraqirkvlddgkcevhfidfgnnavtqqfrqlpeelakparysrhceldasti
    skcdaallqsfidtrfsetfqveilatkgtgthvvrlfyqskniseklqecq
    

    Sequence, based on observed residues (ATOM records):
    >3ntiA (A:)
    elhncvvvqfdgpmsfyvqmesdvpaleqmtdklldaeqdlpafsdlkegalcvaqfped
    evfyraqirkvlddgkcevhfidfgnnavtqqfrqlpeelakparysrhceldastisaa
    llqsfidtrfsetfqveilatkgtgthvvrlfyqskniseklq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3ntiC (C:)
    npviargrgrgrk
    

    Sequence, based on observed residues (ATOM records):
    >3ntiC (C:)
    rgrgrgr