PDB entry 3ntd

View 3ntd on RCSB PDB site
Description: Structure of the Shewanella loihica PV-4 NADH-dependent persulfide reductase C531S Mutant
Deposited on 2010-07-03, released 2010-12-08
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.16
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAD-dependent pyridine nucleotide-disulphide oxidoreductase
    Species: Shewanella loihica [TaxId:323850]
    Gene: Shew_0729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3QAV3 (0-564)
      • engineered mutation (530)
  • Chain 'B':
    Compound: FAD-dependent pyridine nucleotide-disulphide oxidoreductase
    Species: Shewanella loihica [TaxId:323850]
    Gene: Shew_0729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3QAV3 (0-564)
      • engineered mutation (530)
  • Heterogens: COA, CL, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ntdA (A:)
    mkkiliiggvaggasaaararrlsetaeiimfergeyvsfancglpyhisgeiaqrsalv
    lqtpesfkarfnvevrvkhevvaidraaklvtvrrlldgseyqesydtlllspgaapivp
    pipgvdnplthslrnipdmdrilqtiqmnnvehatvvgggfiglemmeslhhlgikttll
    eladqvmtpvdremagfahqairdqgvdlrlgtalsevsyqvqthvasdaagedtahqhi
    kghlsltlsngelletdllimaigvrpetqlardaglaigelggikvnammqtsdpaiya
    vgdaveeqdfvtgqaclvplagpanrqgrmaadnmfgreeryqgtqgtaickvfdlavga
    tgknekqlkqagiafekvyvhtashasyypgaevvsfkllfdpvkgtifgaqavgkdgid
    kridvmavaqragmtveqlqhlelsyappygsakdvinqaafvasniikgdatpihfdqi
    dnlsedqllldvrnpgelqngglegavnipvdelrdrmhelpkdkeiiifsqvglrgnva
    yrqlvnngyrarnliggyrtykfas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3ntdB (B:)
    mkkiliiggvaggasaaararrlsetaeiimfergeyvsfancglpyhisgeiaqrsalv
    lqtpesfkarfnvevrvkhevvaidraaklvtvrrlldgseyqesydtlllspgaapivp
    pipgvdnplthslrnipdmdrilqtiqmnnvehatvvgggfiglemmeslhhlgikttll
    eladqvmtpvdremagfahqairdqgvdlrlgtalsevsyqvqthvasdaagedtahqhi
    kghlsltlsngelletdllimaigvrpetqlardaglaigelggikvnammqtsdpaiya
    vgdaveeqdfvtgqaclvplagpanrqgrmaadnmfgreeryqgtqgtaickvfdlavga
    tgknekqlkqagiafekvyvhtashasyypgaevvsfkllfdpvkgtifgaqavgkdgid
    kridvmavaqragmtveqlqhlelsyappygsakdvinqaafvasniikgdatpihfdqi
    dnlsedqllldvrnpgelqngglegavnipvdelrdrmhelpkdkeiiifsqvglrgnva
    yrqlvnngyrarnliggyrtykfas