PDB entry 3ntc

View 3ntc on RCSB PDB site
Description: Crystal structure of KD-247 Fab, an anti-V3 antibody that inhibits HIV-1 Entry
Class: immune system
Keywords: KD-247, humanized antibody, anti-V3, Fab, IMMUNE SYSTEM
Deposited on 2010-07-03, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.184
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NTC (0-220)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens, Mus musculus [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NTC (0-218)
    Domains in SCOPe 2.07: d3ntcl1, d3ntcl2
  • Heterogens: SO4, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ntcL (L:)
    diqmtqrpdslsasvgdrvtmsckssqsllnsgdqknyltwyqqkpgqppklliywastg
    esgvpdrfsgsgsgtdftftisslqpediatyycqndysypwtfgqgtkveikrtvaaps
    vfifppsdqqlksgtasvvclnnnfypkeakvqwkvdnalqsgnsqesvtqqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgc