PDB entry 3nt9

View 3nt9 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF LSSmKate1 red fluorescent proteins with large Stokes shift
Class: fluorescent protein
Keywords: red fluorescent protein, large Stokes shift, FLUORESCENT PROTEIN
Deposited on 2010-07-03, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LSSmKate1 red fluorescent protein
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NT9
    Domains in SCOPe 2.07: d3nt9a_
  • Chain 'B':
    Compound: LSSmKate1 red fluorescent protein
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NT9
    Domains in SCOPe 2.07: d3nt9b_
  • Chain 'C':
    Compound: LSSmKate1 red fluorescent protein
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NT9
    Domains in SCOPe 2.07: d3nt9c_
  • Chain 'D':
    Compound: LSSmKate1 red fluorescent protein
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NT9
    Domains in SCOPe 2.07: d3nt9d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nt9A (A:)
    mgshhhhhhgrsmselikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggg
    hlicnlkstyrskkpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nt9A (A:)
    elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
    mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
    gvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggghlicnlkstyrskk
    paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nt9B (B:)
    mgshhhhhhgrsmselikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggg
    hlicnlkstyrskkpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nt9B (B:)
    elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
    mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
    gvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggghlicnlkstyrskk
    paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nt9C (C:)
    mgshhhhhhgrsmselikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggg
    hlicnlkstyrskkpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nt9C (C:)
    elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
    mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
    gvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggghlicnlkstyrskk
    paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nt9D (D:)
    mgshhhhhhgrsmselikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggg
    hlicnlkstyrskkpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nt9D (D:)
    elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
    mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
    gvnftsngpvmqkktlgweagtemlypadgglegrsdealklvggghlicnlkstyrskk
    paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl