PDB entry 3nt6

View 3nt6 on RCSB PDB site
Description: Structure of the Shewanella loihica PV-4 NADH-dependent persulfide reductase C43S/C531S Double Mutant
Deposited on 2010-07-02, released 2010-12-08
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.124
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAD-dependent pyridine nucleotide-disulphide oxidoreductase
    Species: Shewanella loihica [TaxId:323850]
    Gene: Shew_0729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3QAV3 (0-End)
      • engineered mutation (42)
      • engineered mutation (530)
  • Chain 'B':
    Compound: FAD-dependent pyridine nucleotide-disulphide oxidoreductase
    Species: Shewanella loihica [TaxId:323850]
    Gene: Shew_0729
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3QAV3 (0-End)
      • engineered mutation (42)
      • engineered mutation (530)
  • Heterogens: CL, FAD, COA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nt6A (A:)
    mkkiliiggvaggasaaararrlsetaeiimfergeyvsfansglpyhisgeiaqrsalv
    lqtpesfkarfnvevrvkhevvaidraaklvtvrrlldgseyqesydtlllspgaapivp
    pipgvdnplthslrnipdmdrilqtiqmnnvehatvvgggfiglemmeslhhlgikttll
    eladqvmtpvdremagfahqairdqgvdlrlgtalsevsyqvqthvasdaagedtahqhi
    kghlsltlsngelletdllimaigvrpetqlardaglaigelggikvnammqtsdpaiya
    vgdaveeqdfvtgqaclvplagpanrqgrmaadnmfgreeryqgtqgtaickvfdlavga
    tgknekqlkqagiafekvyvhtashasyypgaevvsfkllfdpvkgtifgaqavgkdgid
    kridvmavaqragmtveqlqhlelsyappygsakdvinqaafvasniikgdatpihfdqi
    dnlsedqllldvrnpgelqngglegavnipvdelrdrmhelpkdkeiiifsqvglrgnva
    yrqlvnngyrarnliggyrtykfasvlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nt6A (A:)
    mkkiliiggvaggasaaararrlsetaeiimfergeyvsfansglpyhisgeiaqrsalv
    lqtpesfkarfnvevrvkhevvaidraaklvtvrrlldgseyqesydtlllspgaapivp
    pipgvdnplthslrnipdmdrilqtiqmnnvehatvvgggfiglemmeslhhlgikttll
    eladqvmtpvdremagfahqairdqgvdlrlgtalsevsyqvqthvasdaagedtahqhi
    kghlsltlsngelletdllimaigvrpetqlardaglaigelggikvnammqtsdpaiya
    vgdaveeqdfvtgqaclvplagpanrqgrmaadnmfgreeryqgtqgtaickvfdlavga
    tgknekqlkqagiafekvyvhtashasyypgaevvsfkllfdpvkgtifgaqavgkdgid
    kridvmavaqragmtveqlqhlelsyappygsakdvinqaafvasniikgdatpihfdqi
    dnlsedqllldvrnpgelqngglegavnipvdelrdrmhelpkdkeiiifsqvglrgnva
    yrqlvnngyrarnliggyrtykfas
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nt6B (B:)
    mkkiliiggvaggasaaararrlsetaeiimfergeyvsfansglpyhisgeiaqrsalv
    lqtpesfkarfnvevrvkhevvaidraaklvtvrrlldgseyqesydtlllspgaapivp
    pipgvdnplthslrnipdmdrilqtiqmnnvehatvvgggfiglemmeslhhlgikttll
    eladqvmtpvdremagfahqairdqgvdlrlgtalsevsyqvqthvasdaagedtahqhi
    kghlsltlsngelletdllimaigvrpetqlardaglaigelggikvnammqtsdpaiya
    vgdaveeqdfvtgqaclvplagpanrqgrmaadnmfgreeryqgtqgtaickvfdlavga
    tgknekqlkqagiafekvyvhtashasyypgaevvsfkllfdpvkgtifgaqavgkdgid
    kridvmavaqragmtveqlqhlelsyappygsakdvinqaafvasniikgdatpihfdqi
    dnlsedqllldvrnpgelqngglegavnipvdelrdrmhelpkdkeiiifsqvglrgnva
    yrqlvnngyrarnliggyrtykfasvlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nt6B (B:)
    mkkiliiggvaggasaaararrlsetaeiimfergeyvsfansglpyhisgeiaqrsalv
    lqtpesfkarfnvevrvkhevvaidraaklvtvrrlldgseyqesydtlllspgaapivp
    pipgvdnplthslrnipdmdrilqtiqmnnvehatvvgggfiglemmeslhhlgikttll
    eladqvmtpvdremagfahqairdqgvdlrlgtalsevsyqvqthvasdaagedtahqhi
    kghlsltlsngelletdllimaigvrpetqlardaglaigelggikvnammqtsdpaiya
    vgdaveeqdfvtgqaclvplagpanrqgrmaadnmfgreeryqgtqgtaickvfdlavga
    tgknekqlkqagiafekvyvhtashasyypgaevvsfkllfdpvkgtifgaqavgkdgid
    kridvmavaqragmtveqlqhlelsyappygsakdvinqaafvasniikgdatpihfdqi
    dnlsedqllldvrnpgelqngglegavnipvdelrdrmhelpkdkeiiifsqvglrgnva
    yrqlvnngyrarnliggyrtykfas