PDB entry 3nt3

View 3nt3 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF LSSmKate2 red fluorescent proteins with large Stokes shift
Class: fluorescent protein
Keywords: Large Stokes Shift, site-directed mutagenesis, fluorescent protein
Deposited on 2010-07-02, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.175
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LSSmKate2 red fluorescent protein
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NT3
    Domains in SCOPe 2.07: d3nt3a_
  • Chain 'B':
    Compound: LSSmKate2 red fluorescent protein
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NT3
    Domains in SCOPe 2.07: d3nt3b_
  • Chain 'C':
    Compound: LSSmKate2 red fluorescent protein
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NT3
    Domains in SCOPe 2.07: d3nt3c_
  • Chain 'D':
    Compound: LSSmKate2 red fluorescent protein
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NT3
    Domains in SCOPe 2.07: d3nt3d_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nt3A (A:)
    mgshhhhhhgrsmselikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggg
    hlicnlkstyrskkpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nt3A (A:)
    elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
    mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
    gvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggghlicnlkstyrskk
    paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nt3B (B:)
    mgshhhhhhgrsmselikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggg
    hlicnlkstyrskkpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nt3B (B:)
    elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
    mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
    gvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggghlicnlkstyrskk
    paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nt3C (C:)
    mgshhhhhhgrsmselikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggg
    hlicnlkstyrskkpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nt3C (C:)
    selikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilats
    fmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki
    rgvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggghlicnlkstyrsk
    kpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nt3D (D:)
    mgshhhhhhgrsmselikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveg
    gplpfafdilatsfmygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdt
    slqdgcliynvkirgvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggg
    hlicnlkstyrskkpaknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl
    ghkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nt3D (D:)
    elikenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
    mygsytfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
    gvnftsngpvmqkktlgweagtemlypadgglegrsddalklvggghlicnlkstyrskk
    paknlkvpgvyyvdrrlerikeadketyveqhevavarycdlpskl