PDB entry 3nt1

View 3nt1 on RCSB PDB site
Description: high resolution structure of naproxen:cox-2 complex.
Deposited on 2010-07-02, released 2010-09-01
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin-endoperoxide synthase 2
    Species: Mus musculus [TaxId:10090]
    Gene: COX-2 PGHS-B, mCG_5001, Ptgs2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Prostaglandin-endoperoxide synthase 2
    Species: Mus musculus [TaxId:10090]
    Gene: COX-2 PGHS-B, mCG_5001, Ptgs2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, BOG, NPS, HEM, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nt1A (A:)
    anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpefltriklllkptpntvhyi
    lthfkgvwnivnnipflrslimkyvltsrsylidspptynvhygyksweafsnlsyytra
    lppvaddcptpmgvkgnkelpdskevlekvllrrefipdpqgsnmmfaffaqhfthqffk
    tdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgklkyqviggevypptvkdtqv
    emiypphipenlqfavgqevfglvpglmmyatiwlrehnrvcdilkqehpewgdeqlfqt
    srliligetikiviedyvqhlsgyhfklkfdpellfnqqfqyqnriasefntlyhwhpll
    pdtfniedqeysfkqflynnsillehgltqfvesftrqiagrvaggrnvpiavqavakas
    idqsremkyqslneyrkrfslkpytsfeeltgekemaaelkalysdidvmelypallvek
    prpdaifgetmvelgapfslkglmgnpicspqywkpstfggevgfkiintasiqslicnn
    vkgcpftsfnvqdpqptktatinasashsrlddinptvlikrrstel
    

    Sequence, based on observed residues (ATOM records):
    >3nt1A (A:)
    anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpefltriklllkptpntvhyi
    lthfkgvwnivnnipflrslimkyvltsrsylidspptynvhygyksweafsnlsyytra
    lppvaddcptpmgvkgnkelpdskevlekvllrrefipdpqgsnmmfaffaqhfthqffk
    tdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgklkyqviggevypptvkdtqv
    emiypphipenlqfavgqevfglvpglmmyatiwlrehnrvcdilkqehpewgdeqlfqt
    srliligetikiviedyvqhlsgyhfklkfdpellfnqqfqyqnriasefntlyhwhpll
    pdtfniedqeysfkqflynnsillehgltqfvesftrqiagrvaggrnvpiavqavakas
    idqsremkyqslneyrkrfslkpytsfeeltgekemaaelkalysdidvmelypallvek
    prpdaifgetmvelgapfslkglmgnpicspqywkpstfggevgfkiintasiqslicnn
    vkgcpftsfnvq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nt1B (B:)
    anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpefltriklllkptpntvhyi
    lthfkgvwnivnnipflrslimkyvltsrsylidspptynvhygyksweafsnlsyytra
    lppvaddcptpmgvkgnkelpdskevlekvllrrefipdpqgsnmmfaffaqhfthqffk
    tdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgklkyqviggevypptvkdtqv
    emiypphipenlqfavgqevfglvpglmmyatiwlrehnrvcdilkqehpewgdeqlfqt
    srliligetikiviedyvqhlsgyhfklkfdpellfnqqfqyqnriasefntlyhwhpll
    pdtfniedqeysfkqflynnsillehgltqfvesftrqiagrvaggrnvpiavqavakas
    idqsremkyqslneyrkrfslkpytsfeeltgekemaaelkalysdidvmelypallvek
    prpdaifgetmvelgapfslkglmgnpicspqywkpstfggevgfkiintasiqslicnn
    vkgcpftsfnvqdpqptktatinasashsrlddinptvlikrrstel
    

    Sequence, based on observed residues (ATOM records):
    >3nt1B (B:)
    anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpefltriklllkptpntvhyi
    lthfkgvwnivnnipflrslimkyvltsrsylidspptynvhygyksweafsnlsyytra
    lppvaddcptpmgvkgnkelpdskevlekvllrrefipdpqgsnmmfaffaqhfthqffk
    tdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgklkyqviggevypptvkdtqv
    emiypphipenlqfavgqevfglvpglmmyatiwlrehnrvcdilkqehpewgdeqlfqt
    srliligetikiviedyvqhlsgyhfklkfdpellfnqqfqyqnriasefntlyhwhpll
    pdtfniedqeysfkqflynnsillehgltqfvesftrqiagrvaggrnvpiavqavakas
    idqsremkyqslneyrkrfslkpytsfeeltgekemaaelkalysdidvmelypallvek
    prpdaifgetmvelgapfslkglmgnpicspqywkpstfggevgfkiintasiqslicnn
    vkgcpftsfnvq