PDB entry 3nsx

View 3nsx on RCSB PDB site
Description: The crystal structure of the The crystal structure of the D420A mutant of the alpha-glucosidase (FAMILY 31) from Ruminococcus obeum ATCC 29174
Deposited on 2010-07-02, released 2010-07-21
The last revision was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.155
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucosidase
    Species: Ruminococcus obeum [TaxId:411459]
    Gene: RUMOBE_03919
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5ZY13 (3-665)
      • expression tag (0-2)
      • engineered (422)
  • Chain 'B':
    Compound: alpha-glucosidase
    Species: Ruminococcus obeum [TaxId:411459]
    Gene: RUMOBE_03919
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5ZY13 (3-665)
      • expression tag (0-2)
      • engineered (422)
  • Heterogens: TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nsxA (A:)
    snamirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesn
    rginkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytr
    mdtlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedf
    ravakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiida
    gvkvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrfli
    dqgiegfwndmnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedy
    krfyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiw
    mgankswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrd
    haaegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddk
    mairvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvd
    valnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkken
    yrvltk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nsxB (B:)
    snamirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesn
    rginkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytr
    mdtlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedf
    ravakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiida
    gvkvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrfli
    dqgiegfwndmnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedy
    krfyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiw
    mgankswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrd
    haaegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddk
    mairvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvd
    valnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkken
    yrvltk