PDB entry 3nsw

View 3nsw on RCSB PDB site
Description: Crystal Structure of Ancylostoma ceylanicum Excretory-Secretory Protein 2
Deposited on 2010-07-02, released 2011-05-18
The last revision was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.148
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Excretory-secretory protein 2
    Species: Ancylostoma ceylanicum [TaxId:53326]
    Gene: ES-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6R7N7 (4-105)
      • expression tag (0-3)
  • Chain 'B':
    Compound: Excretory-secretory protein 2
    Species: Ancylostoma ceylanicum [TaxId:53326]
    Gene: ES-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6R7N7 (4-105)
      • expression tag (0-3)
  • Chain 'C':
    Compound: Excretory-secretory protein 2
    Species: Ancylostoma ceylanicum [TaxId:53326]
    Gene: ES-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6R7N7 (4-105)
      • expression tag (0-3)
  • Chain 'D':
    Compound: Excretory-secretory protein 2
    Species: Ancylostoma ceylanicum [TaxId:53326]
    Gene: ES-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6R7N7 (4-105)
      • expression tag (0-3)
  • Chain 'E':
    Compound: Excretory-secretory protein 2
    Species: Ancylostoma ceylanicum [TaxId:53326]
    Gene: ES-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6R7N7 (4-105)
      • expression tag (0-3)
  • Chain 'F':
    Compound: Excretory-secretory protein 2
    Species: Ancylostoma ceylanicum [TaxId:53326]
    Gene: ES-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6R7N7 (4-105)
      • expression tag (0-3)
  • Chain 'G':
    Compound: Excretory-secretory protein 2
    Species: Ancylostoma ceylanicum [TaxId:53326]
    Gene: ES-2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MPD, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nswA (A:)
    gshmeycpkmlseirqedindvetvayvtvtgktarsynlqywrlydvpktapsqwpsfg
    tlrddcgniqltadtdyvlgcksgnqdcfvklhdglsqkekdllke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nswB (B:)
    gshmeycpkmlseirqedindvetvayvtvtgktarsynlqywrlydvpktapsqwpsfg
    tlrddcgniqltadtdyvlgcksgnqdcfvklhdglsqkekdllke
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3nswC (C:)
    gshmeycpkmlseirqedindvetvayvtvtgktarsynlqywrlydvpktapsqwpsfg
    tlrddcgniqltadtdyvlgcksgnqdcfvklhdglsqkekdllke
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3nswD (D:)
    gshmeycpkmlseirqedindvetvayvtvtgktarsynlqywrlydvpktapsqwpsfg
    tlrddcgniqltadtdyvlgcksgnqdcfvklhdglsqkekdllke
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3nswE (E:)
    gshmeycpkmlseirqedindvetvayvtvtgktarsynlqywrlydvpktapsqwpsfg
    tlrddcgniqltadtdyvlgcksgnqdcfvklhdglsqkekdllke
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >3nswF (F:)
    gshmeycpkmlseirqedindvetvayvtvtgktarsynlqywrlydvpktapsqwpsfg
    tlrddcgniqltadtdyvlgcksgnqdcfvklhdglsqkekdllke
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3nswG (G:)
    gshmeycpkmlseirqedindvetvayvtvtgktarsynlqywrlydvpktapsqwpsfg
    tlrddcgniqltadtdyvlgcksgnqdcfvklhdglsqkekdllke
    

    Sequence, based on observed residues (ATOM records):
    >3nswG (G:)
    ycpkmlseirqdindvetvayvtvtgktarsynlqywrlydvpktappsfgtlrddciql
    tadtdyvlgcksgnqdcfvklhdglsqkekdllk