PDB entry 3nsv

View 3nsv on RCSB PDB site
Description: Crystal Structure of human ABL2 in complex with Aurora Kinase Inhibitor VX-680
Class: transferase
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, Kinase, TRANSFERASE
Deposited on 2010-07-02, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG, hCG_23565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nsva_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG, hCG_23565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nsvb_
  • Chain 'C':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2, ABLL, ARG, hCG_23565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nsvc_
  • Heterogens: VX6, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nsvA (A:)
    mghhhhhhssgvdlgtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltv
    avktlkedtmeveeflkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylr
    ecnreevtavvllymatqissameylekknfihrdlaarnclvgenhvvkvadfglsrlm
    tgdtytahagakfpikwtapeslayntfsiksdvwafgvllweiatygmspypgidlsqv
    ydllekgyrmeqpegcppkvyelmracwkwspadrpsfaethqafetmfhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsvA (A:)
    kwemertditmkhklgggqygevyvgvwkkysltvavktldtmeveeflkeaavmkeikh
    pnlvqllgvctleppfyivteympygnlldylrecnreevtavvllymatqissameyle
    kknfihrdlaarnclvgenhvvkvadfglsrlmtgdtytahagakfpikwtapeslaynt
    fsiksdvwafgvllweiatygmspypgidlsqvydllekgyrmeqpegcppkvyelmrac
    wkwspadrpsfaethqafetmfhd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nsvB (B:)
    mghhhhhhssgvdlgtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltv
    avktlkedtmeveeflkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylr
    ecnreevtavvllymatqissameylekknfihrdlaarnclvgenhvvkvadfglsrlm
    tgdtytahagakfpikwtapeslayntfsiksdvwafgvllweiatygmspypgidlsqv
    ydllekgyrmeqpegcppkvyelmracwkwspadrpsfaethqafetmfhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsvB (B:)
    kwemertditmkhklgggqygevyvgvwkkysltvavktldtmeveeflkeaavmkeikh
    pnlvqllgvctleppfyivteympygnlldylrecnreevtavvllymatqissameyle
    kknfihrdlaarnclvgenhvvkvadfglsrlmtgdtytahagakfpikwtapeslaynt
    fsiksdvwafgvllweiatygmspypgidlsqvydllekgyrmeqpegcppkvyelmrac
    wkwspadrpsfaethqafetmfhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nsvC (C:)
    mghhhhhhssgvdlgtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltv
    avktlkedtmeveeflkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylr
    ecnreevtavvllymatqissameylekknfihrdlaarnclvgenhvvkvadfglsrlm
    tgdtytahagakfpikwtapeslayntfsiksdvwafgvllweiatygmspypgidlsqv
    ydllekgyrmeqpegcppkvyelmracwkwspadrpsfaethqafetmfhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsvC (C:)
    wemertditmkhklgggqygevyvgvwkkysltvavktlktmeveeflkeaavmkeikhp
    nlvqllgvctleppfyivteympygnlldylrecnreevtavvllymatqissameylek
    knfihrdlaarnclvgenhvvkvadfglsrlmtgdtytahagakfpikwtapeslayntf
    siksdvwafgvllweiatygmspypgidlsqvydllekgyrmeqpegcppkvyelmracw
    kwspadrpsfaethqafetmfh