PDB entry 3nsu

View 3nsu on RCSB PDB site
Description: A Systematic Screen for Protein-Lipid Interactions in Saccharomyces cerevisiae
Deposited on 2010-07-02, released 2010-12-15
The last revision was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIT2, SLM1, YIL105C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40485 (5-End)
      • expression tag (2-4)
  • Chain 'B':
    Compound: Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIT2, SLM1, YIL105C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40485 (5-End)
      • expression tag (2-4)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nsuA (A:)
    dhpfteiksgflerrskflksyskgyyvltpnflhefktadrkkdlvpvmslalsectvt
    ehsrknstsspnstgsdakfvlhakqngiirrghnwvfkadsyesmmswfdnlkiltsts
    

    Sequence, based on observed residues (ATOM records):
    >3nsuA (A:)
    pfteiksgflerrskflksyskgyyvltpnflhefktadrkkdlvpvmslalsectvteh
    srknstsspnstgsdakfvlhakhnwvfkadsyesmmswfdnlkiltst
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nsuB (B:)
    dhpfteiksgflerrskflksyskgyyvltpnflhefktadrkkdlvpvmslalsectvt
    ehsrknstsspnstgsdakfvlhakqngiirrghnwvfkadsyesmmswfdnlkiltsts
    

    Sequence, based on observed residues (ATOM records):
    >3nsuB (B:)
    pfteiksgflerrskflksyskgyyvltpnflhefktadrkkdlvpvmslalsectvteh
    srknstgsdakfvlhakhnwvfkadsyesmmswfdnlkiltst