SCOPe 2.06: Structural Classification of Proteins

PDB entry 3nsr

View 3nsr on RCSB PDB site
Description: X-RAY Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with 5-Fluorouracil at 2.2 A Resolution
Class: transferase
Keywords: Rossmann Fold, drug metabolism, TRANSFERASE
Deposited on 2010-07-02, released 2011-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6 (Start-252)
Domains in SCOPe 2.06: d3nsra_
Chain 'B':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6 (Start-252)
Domains in SCOPe 2.06: d3nsrb_
Chain 'C':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6 (Start-252)
Domains in SCOPe 2.06: d3nsrc_
Chain 'D':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6 (Start-252)
Domains in SCOPe 2.06: d3nsrd_
Chain 'E':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6 (Start-252)
Domains in SCOPe 2.06: d3nsre_
Chain 'F':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6 (Start-252)
Domains in SCOPe 2.06: d3nsrf_
Chain 'G':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6 (Start-252)
Domains in SCOPe 2.06: d3nsrg_
Chain 'H':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6 (Start-252)
Domains in SCOPe 2.06: d3nsrh_
Chain 'I':
Compound: Uridine phosphorylase
Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
Gene: SPA3809, stm3968, stmd1.21, udp
Database cross-references and differences (RAF-indexed):
- Uniprot Q5PKP6
Domains in SCOPe 2.06: d3nsri_
Heterogens: K, URF, GOL, AZI, PG4, EDO, PEG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3nsrA (A:)
msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
avkivveaarrll