PDB entry 3nsr

View 3nsr on RCSB PDB site
Description: X-RAY Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with 5-Fluorouracil at 2.2 A Resolution
Class: transferase
Keywords: Rossmann Fold, drug metabolism, TRANSFERASE
Deposited on 2010-07-02, released 2011-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsra_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsrb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsrc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsrd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsre_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsrf_
  • Chain 'G':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsrg_
  • Chain 'H':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsrh_
  • Chain 'I':
    Compound: Uridine phosphorylase
    Species: Salmonella enterica subsp. enterica serovar Paratyphi A [TaxId:54388]
    Gene: SPA3809, stm3968, stmd1.21, udp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nsri_
  • Heterogens: K, URF, GOL, AZI, PG4, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nsrA (A:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrA (A:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnatmkqteshavki
    vveaarrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nsrB (B:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrB (B:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetkqteshavki
    vveaarrll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nsrC (C:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrC (C:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtehavki
    vveaarrll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nsrD (D:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrD (D:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaemqteshavkiv
    veaarrll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nsrE (E:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrE (E:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeiptmkqteshavkivv
    eaarrll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nsrF (F:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrF (F:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqeipnetmkqteshavkiv
    veaarrll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3nsrG (G:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrG (G:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkteshavki
    vveaarrll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3nsrH (H:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrH (H:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipaetqtehavkivve
    aarrll
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3nsrI (I:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsrI (I:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqeshavki
    vveaarrl