PDB entry 3nsp

View 3nsp on RCSB PDB site
Description: Crystal structure of tetrameric RXRalpha-LBD
Class: transcription
Keywords: nuclear receptor retinoic x recepor alpha ligand binding domain, TRANSCRIPTION
Deposited on 2010-07-02, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.226
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoid X receptor, alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1, RP11-473E2.1-002, hCG_18150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nspa_
  • Chain 'B':
    Compound: Retinoid X receptor, alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1, RP11-473E2.1-002, hCG_18150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nspb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nspA (A:)
    tssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvew
    akriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagv
    gaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyaslea
    yckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nspA (A:)
    dpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkd
    gillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskg
    lsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkli
    gdtpidtflmeml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nspB (B:)
    tssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvew
    akriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagv
    gaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyaslea
    yckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nspB (B:)
    qaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgilllhv
    hrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaeveal
    rekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflm
    emleaphqmt