PDB entry 3nsm

View 3nsm on RCSB PDB site
Description: Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 from Ostrinia furnacalis
Deposited on 2010-07-02, released 2010-11-24
The last revision was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosaminidase
    Species: Ostrinia furnacalis [TaxId:93504]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nsmA (A:)
    edvvwrwscdngkcvklkndprssepalsleackmfcneygllwprptgeadlgnflski
    nlnsievkilkkgatddlmeaaakrfkeqvslaiprgstpkltgkavdvylvnenpneka
    fslemdesyglrvspsgadrvnatitansffgmrhgletlsqlfvfddirdhllmvrdvn
    isdkpvypyrgilldtarnyysiesikrtieamaavklntfhwhitdsqsfpfvttkrpn
    lykfgalspqkvytkaairevvrfglergvrvlpefdapahvgegwqdtdltvcfkaepw
    ksycveppcgqlnptkdelyqylediysdmaevfdttdifhmggdevseacwnssdsiqn
    fmmqnrwdldkesflklwnyfqqkaqdkaykafgkklplilwtstltnykhiddylnkdd
    yiiqvwttgvdpqikgllekgyrlimsnydalyfdcgygawvgagnnwcspyigwqkvyd
    nspavialehrdqvlggeaalwseqsdtstldgrlwpraaalaerlwaepatswqdaeyr
    mlhirerlvrmgiqaeslqpewcyqnegycys