PDB entry 3nsl

View 3nsl on RCSB PDB site
Description: Crystal Structure of S100A3 C30A+C68A double mutant expressed in insect cell
Class: metal binding protein
Keywords: EF-hand, Ca2+, Zn2+ binding, METAL BINDING PROTEIN
Deposited on 2010-07-02, released 2011-03-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A3
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A3, S100E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33764 (0-End)
      • engineered mutation (28)
      • engineered mutation (66)
    Domains in SCOPe 2.05: d3nsla_
  • Chain 'B':
    Compound: Protein S100-A3
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A3, S100E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33764
      • engineered mutation (28)
      • engineered mutation (66)
    Domains in SCOPe 2.05: d3nslb_
  • Chain 'C':
    Compound: Protein S100-A3
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A3, S100E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33764 (0-End)
      • engineered mutation (28)
      • engineered mutation (66)
    Domains in SCOPe 2.05: d3nslc_
  • Chain 'D':
    Compound: Protein S100-A3
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A3, S100E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33764
      • engineered mutation (28)
      • engineered mutation (66)
    Domains in SCOPe 2.05: d3nsld_
  • Chain 'E':
    Compound: Protein S100-A3
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A3, S100E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33764 (0-End)
      • engineered mutation (28)
      • engineered mutation (66)
    Domains in SCOPe 2.05: d3nsle_
  • Chain 'F':
    Compound: Protein S100-A3
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A3, S100E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33764 (0-End)
      • engineered mutation (28)
      • engineered mutation (66)
    Domains in SCOPe 2.05: d3nslf_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nslA (A:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcpseppcsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nslA (A:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nslB (B:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcpseppcsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nslB (B:)
    rpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsvl
    dtnkdaevdfveyvrslaclclycheyfkdcp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nslC (C:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcpseppcsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nslC (C:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nslD (D:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcpseppcsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nslD (D:)
    rpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsvl
    dtnkdaevdfveyvrslaclclycheyfkdcp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nslE (E:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcpseppcsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nslE (E:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nslF (F:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcpseppcsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nslF (F:)
    arpleqavaaivctfqeyagrcgdkyklaqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdaevdfveyvrslaclclycheyfkdcp