PDB entry 3nsk

View 3nsk on RCSB PDB site
Description: Crystal Structure of the Post-Refolded S100A3 R51A Mutant Expressed in Insect Cell
Class: metal binding protein
Keywords: EF-hand, Ca2+, Zn2+-binding, METAL BINDING PROTEIN
Deposited on 2010-07-01, released 2011-03-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.196
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A3
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A3, S100E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33764
      • engineered mutation (50)
    Domains in SCOPe 2.05: d3nska1
  • Chain 'B':
    Compound: Protein S100-A3
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A3, S100E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33764
      • engineered mutation (50)
    Domains in SCOPe 2.05: d3nskb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3nskA (A:)
marpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefaecdynkfms
vldtnkdcevdfveyvrslaclclycheyfkdcpseppcsq

    Sequence, based on observed residues (ATOM records): (download) 
    >3nskA (A:)
rpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefaecdynkfmsvl
dtnkdcevdfveyvrslaclclycheyfkdcc

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3nskB (B:)
marpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefaecdynkfms
vldtnkdcevdfveyvrslaclclycheyfkdcpseppcsq

    Sequence, based on observed residues (ATOM records): (download) 
    >3nskB (B:)
rpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefaecdynkfmsvl
dtnkdcevdfveyvrslaclclycheyfkdcpc