PDB entry 3nsj

View 3nsj on RCSB PDB site
Description: The X-ray crystal structure of lymphocyte perforin
Deposited on 2010-07-01, released 2010-11-03
The last revision was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.197
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Perforin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Prf1, Pfp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10820 (0-End)
      • engineered mutation (192)
  • Heterogens: GOL, CA, IOD, CL, NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nsjA (A:)
    pcytatrseckqkhkfvpgvwmagegmdvttlrrsgsfpvntqrflrpdrtctlcknslm
    rdatqrlpvaithwrphsshcqrnvaaakvhstegvareaaaninndwrvgldvnprpea
    nmrasvagshskvanfaaektyqdqynfnsdtvecrmysfrlvqkpplhldfkkalralp
    rnfnsstehayhelissygthfitavdlggrisvltalrtcqltlngltadevgdclnve
    aqvsigaqasvsseykaceekkkqhkmatsfhqtyrerhvevlggpldsthdllfgnqat
    peqfstwtaslpsnpglvdysleplhtlleeqnpkrealrqaishyimsrarwqncsrpc
    rsgqhksshdscqcecqdskvtnqdccprqrglahlvvsnfraehlwgdyttatdaylkv
    ffggqefrtgvvwnnnnprwtdkmdfenvllstggplrvqvwdadygwdddllgscdrsp
    hsgfhevtcelnhgrvkfsyhakclphltggtcleyapqgllgdppgnrsgavwhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nsjA (A:)
    pcytatrseckqkhkfvpgvwmagegmdvttlrrsgsfpvntqrflrpdrtctlcknslm
    rdatqrlpvaithwrphsshcqrnvaaakvhstegvareaaaninndwrvgldvnrpean
    mrasvagshskvanfaaektyqdqynfnsdtvecrmysfrlvqkpplhldfkkalralpr
    nfnsstehayhelissygthfitavdlggrisvltalrtcqltlngltadevgdclnvea
    qvsigaqasvsseykaceekkkqhkmatsfhqtyrerhvevlggpldsthdllfgnqatp
    eqfstwtaslpsnpglvdysleplhtlleeqnpkrealrqaishyimsrarwqncsrpcr
    sgqhksshdscqcecqdskvtnqdccprqrglahlvvsnfraehlwgdyttatdaylkvf
    fggqefrtgvvwnnnnprwtdkmdfenvllstggplrvqvwdadygwdddllgscdrsph
    sgfhevtcelnhgrvkfsyhakclphltggtcleyapqgllgdppgnrsg