PDB entry 3nsf

View 3nsf on RCSB PDB site
Description: Apo form of the multicopper oxidase CueO
Class: oxidoreductase
Keywords: multicopper oxidase, apo form, no copper, OXIDOREDUCTASE
Deposited on 2010-07-01, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blue copper oxidase cueO
    Species: Escherichia coli [TaxId:562]
    Gene: b0123, cueO, CueO (YacK), JW0119, yacK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36649 (0-487)
      • expression tag (488-494)
    Domains in SCOPe 2.07: d3nsfa1, d3nsfa2, d3nsfa3, d3nsfa4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nsfA (A:)
    aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv
    diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt
    grqvamglaglvvieddeilklmlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavg
    wfgdtlltngaiypqhaaprgwlrlrllngcnarslnfatsdnrplyviasdggllpepv
    kvselpvlmgerfevlvevndnkpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasg
    alpdtlsslpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghm
    ghgnmnhmnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhih
    gtqfrilsengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedt
    gmmlgftvlqgdhglsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nsfA (A:)
    aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv
    diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt
    grqvamglaglvvieddeilklmlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavg
    wfgdtlltngaiypqhaaprgwlrlrllngcnarslnfatsdnrplyviasdggllpepv
    kvselpvlmgerfevlvevndnkpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasg
    alpdtlsslpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmhmnhggkfd
    fhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppa
    ahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgftvlqgdhgl