PDB entry 3nsc

View 3nsc on RCSB PDB site
Description: C500S MUTANT OF CueO BOUND TO Cu(II)
Class: oxidoreductase
Keywords: multicopper oxidase, T1 depleted C500S mutation, OXIDOREDUCTASE
Deposited on 2010-07-01, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blue copper oxidase cueO
    Species: Escherichia coli [TaxId:562]
    Gene: b0123, cueO, CueO (YacK), JW0119, yacK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36649 (Start-487)
      • engineered mutation (471)
      • expression tag (488-493)
    Domains in SCOPe 2.07: d3nsca1, d3nsca2, d3nsca3, d3nsca4
  • Heterogens: CU, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nscA (A:)
    aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv
    diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt
    grqvamglaglvvieddeilklmlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavg
    wfgdtlltngaiypqhaaprgwlrlrllngcnarslnfatsdnrplyviasdggllpepv
    kvselpvlmgerfevlvevndnkpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasg
    alpdtlsslpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghm
    ghgnmnhmnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhih
    gtqfrilsengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahshllehedt
    gmmlgftvlqgdhglsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nscA (A:)
    erptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvd
    iynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktg
    rqvamglaglvvieddeilklmlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgw
    fgdtlltngaiypqhaaprgwlrlrllngcnarslnfatsdnrplyviasdggllpepvk
    vselpvlmgerfevlvevndnkpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasga
    lpdtlsslpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfhhanking
    qafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdt
    vkvegnvsevlvkfnhdapkehaymahshllehedtgmmlgftvlqgdhg