PDB entry 3ns7

View 3ns7 on RCSB PDB site
Description: succinic acid amides as p2-p3 replacements for inhibitors of interleukin-1beta converting enzyme (ice or caspase 1)
Deposited on 2010-07-01, released 2011-08-17
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caspase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Caspase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP1, IL1BC, IL1BCE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 3NS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ns7A (A:)
    csleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaevditgmtmllqn
    lgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregicgkkhseqvpdi
    lqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3ns7B (B:)
    aikkahiekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfs
    feqpdgraqmpttervtltrcfylfpgh