PDB entry 3ns6

View 3ns6 on RCSB PDB site
Description: Crystal structure of hte RNA recognition motif of yeast eIF3b residues 76-170
Deposited on 2010-07-01, released 2010-10-06
The last revision was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.143
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 3 subunit B
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC63, PRT1, YOR361C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06103 (5-End)
      • expression tag (0-4)
  • Chain 'B':
    Compound: Eukaryotic translation initiation factor 3 subunit B
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC63, PRT1, YOR361C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06103 (5-End)
      • expression tag (0-4)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ns6A (A:)
    gplgsdqyivvngapvipsakvpvlkkaltslfskagkvvnmefpideatgktkgflfve
    cgsmndakkiiksfhgkrldlkhrlflytmkdverynsdd
    

    Sequence, based on observed residues (ATOM records):
    >3ns6A (A:)
    gplgsdqyivvngapvipsakvpvlkkaltslfskagkvvnmefpideatgktkgflfve
    cgsmndakkiiksfhgkrldlkhrlflytmkdverynsd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ns6B (B:)
    gplgsdqyivvngapvipsakvpvlkkaltslfskagkvvnmefpideatgktkgflfve
    cgsmndakkiiksfhgkrldlkhrlflytmkdverynsdd
    

    Sequence, based on observed residues (ATOM records):
    >3ns6B (B:)
    gplgsdqyivvngapvipsakvpvlkkaltslfskagkvvnmefpideatgktkgflfve
    cgsmndakkiiksfhgkrldlkhrlflytmkdverynsd