PDB entry 3ns5

View 3ns5 on RCSB PDB site
Description: Crystal structure of the RNA recognition motif of yeast eIF3b residues 76-161
Deposited on 2010-07-01, released 2010-10-06
The last revision was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 3 subunit B
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC63, PRT1, YOR361C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06103 (5-90)
      • expression tag (1-4)
  • Chain 'B':
    Compound: Eukaryotic translation initiation factor 3 subunit B
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CDC63, PRT1, YOR361C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06103 (5-90)
      • expression tag (1-4)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ns5A (A:)
    gplgsdqyivvngapvipsakvpvlkkaltslfskagkvvnmefpideatgktkgflfve
    cgsmndakkiiksfhgkrldlkhrlflytmk
    

    Sequence, based on observed residues (ATOM records):
    >3ns5A (A:)
    plgsdqyivvngapvipsakvpvlkkaltslfskagkvvnmefpideatgktkgflfvec
    gsmndakkiiksfhgkrldlkhrlflytmk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ns5B (B:)
    gplgsdqyivvngapvipsakvpvlkkaltslfskagkvvnmefpideatgktkgflfve
    cgsmndakkiiksfhgkrldlkhrlflytmk
    

    Sequence, based on observed residues (ATOM records):
    >3ns5B (B:)
    plgsdqyivvngapvipsakvpvlkkaltslfskagkvvnmefpideatgktkgflfvec
    gsmndakkiiksfhgkrldlkhrlflytmk