PDB entry 3ns0

View 3ns0 on RCSB PDB site
Description: X-ray structure of bacteriorhodopsin
Class: membrane protein
Keywords: ION PUMP, MEMBRANE PROTEIN, RETINAL PROTEIN, PHOTORECEPTOR, MEROHEDRAL TWINNING, 7-helix transmembrane, ion transport, Membrane
Deposited on 2010-07-01, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ns0a_
  • Heterogens: RET, LI1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ns0A (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ns0A (A:)
    grpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgyg
    ltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvg
    altkvysyrfvwwaistaamlyilyvlffgkaesmrpevastfkvlrnvtvvlwsaypvv
    wligsegagivplnietllfmvldvsakvgfglillrsraifg