PDB entry 3nrz

View 3nrz on RCSB PDB site
Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Hypoxanthine
Class: oxidoreductase
Keywords: xanthine oxidase, hypoxanthine, substrate orientation, hydroxylase, OXIDOREDUCTASE
Deposited on 2010-07-01, released 2010-07-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3nrza1, d3nrza2
  • Chain 'B':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3nrzb1, d3nrzb2
  • Chain 'C':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3nrzc1, d3nrzc2
  • Chain 'J':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3nrzj1, d3nrzj2
  • Chain 'K':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3nrzk1, d3nrzk2
  • Chain 'L':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3nrzl1, d3nrzl2
  • Heterogens: FES, FAD, MTE, MOS, HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nrzA (A:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nrzB (B:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nrzC (C:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnck
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nrzJ (J:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nrzK (K:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3nrzL (L:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnck
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nrzL (L:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkftt