PDB entry 3nry

View 3nry on RCSB PDB site
Description: Insights into anti-parallel microtubule crosslinking by PRC1, a conserved microtubule binding protein
Deposited on 2010-07-01, released 2010-08-25
The last revision was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.24
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein regulator of cytokinesis 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43663 (4-129)
      • expression tag (0-3)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nryA (A:)
    gaaalknyyevhkelfegvqkweetwrlfleferkasdpnrftnrggnllkeekqraklq
    kmlpkleeelkarielweqehskafmvngqkfmeyvaeqwemhrlekerakqerqlknkk
    qtetemlygs
    

    Sequence, based on observed residues (ATOM records):
    >3nryA (A:)
    gaaalknyyevhkelfegvqkweetwrlfleferkasdpnrftnlkeekqraklqkmlpk
    leeelkarielweqehskafmvngqkfmeyvaeqwemhrlekerakqerqlknkkqtete
    mlygs