PDB entry 3nrx

View 3nrx on RCSB PDB site
Description: Insights into anti-parallel microtubule crosslinking by PRC1, a conserved non-motor microtubule binding protein
Deposited on 2010-06-30, released 2010-08-18
The last revision was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein regulator of cytokinesis 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43663 (4-129)
      • expression tag (2-3)
  • Chain 'B':
    Compound: Protein regulator of cytokinesis 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43663 (4-End)
      • expression tag (2-3)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrxA (A:)
    gaaalknyyevhkelfegvqkweetwrlfleferkasdpnrftnrggnllkeekqraklq
    kmlpkleeelkarielweqehskafmvngqkfmeyvaeqwemhrlekerakqerqlknkk
    qtetemlygs
    

    Sequence, based on observed residues (ATOM records):
    >3nrxA (A:)
    aalknyyevhkelfegvqkweetwrlfleferkasdpnrfnllkeekqraklqkmlpkle
    eelkarielweqehskafmvngqkfmeyvaeqwemhrlekerakqerqlknkkqteteml
    ygs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nrxB (B:)
    gaaalknyyevhkelfegvqkweetwrlfleferkasdpnrftnrggnllkeekqraklq
    kmlpkleeelkarielweqehskafmvngqkfmeyvaeqwemhrlekerakqerqlknkk
    qtetemlygs
    

    Sequence, based on observed residues (ATOM records):
    >3nrxB (B:)
    aalknyyevhkelfegvqkweetwrlfleferkasdpnllkeekqraklqkmlpkleeel
    karielweqehskafmvngqkfmeyvaeqwemhrlekerakqerqlknkkqtetemly