PDB entry 3nrw

View 3nrw on RCSB PDB site
Description: Crystal Structure of the N-terminal domain of Phage integrase/site-specific recombinase (tnp) from Haloarcula marismortui, Northeast Structural Genomics Consortium Target HmR208A
Deposited on 2010-06-30, released 2010-08-25
The last revision was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phage integrase/site-specific recombinase
    Species: Haloarcula marismortui [TaxId:2238]
    Gene: rrnAC0581, tnp
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrwA (A:)
    mterpslspreardrylahrqtdaadasiksfryrlkhfvewaeerditamreltgwkld
    eyetfrrgsdvspatlngemqtlknwleylaridvvdedlpekvhvptilehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nrwA (A:)
    rpslspreardrylahrqtdaadasiksfryrlkhfvewaeerditamreltgwkldeye
    tfrrgsdvspatlngemqtlknwleylaridvvdedlpekvhvp