PDB entry 3nrv

View 3nrv on RCSB PDB site
Description: Crystal structure of MarR/EmrR family transcriptional regulator from Acinetobacter sp. ADP1
Deposited on 2010-06-30, released 2010-09-15
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator (MarR/EmrR family)
    Species: Acinetobacter sp. ADP1 [TaxId:62977]
    Gene: 2878967, ACIAD1811
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative transcriptional regulator (MarR/EmrR family)
    Species: Acinetobacter sp. ADP1 [TaxId:62977]
    Gene: 2878967, ACIAD1811
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative transcriptional regulator (MarR/EmrR family)
    Species: Acinetobacter sp. ADP1 [TaxId:62977]
    Gene: 2878967, ACIAD1811
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Putative transcriptional regulator (MarR/EmrR family)
    Species: Acinetobacter sp. ADP1 [TaxId:62977]
    Gene: 2878967, ACIAD1811
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrvA (A:)
    snamqkinidrhataqinmlanklmlksstaytqkfgigmtewriisvlssasdcsvqki
    sdilgldkaavsrtvkkleekkyievnghsedkrtyainltemgqelyevasdfaierek
    qlleefeeaekdqlfillkklrnkvdqm
    

    Sequence, based on observed residues (ATOM records):
    >3nrvA (A:)
    qkinidrhataqinmlanklmlkytqkfgigmtewriisvlssasdcsvqkisdilgldk
    aavsrtvkkleekkyievyainltemgqelyevasdfaierekqlleefeeaekdqlfil
    lkklrnkvdqm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nrvB (B:)
    snamqkinidrhataqinmlanklmlksstaytqkfgigmtewriisvlssasdcsvqki
    sdilgldkaavsrtvkkleekkyievnghsedkrtyainltemgqelyevasdfaierek
    qlleefeeaekdqlfillkklrnkvdqm
    

    Sequence, based on observed residues (ATOM records):
    >3nrvB (B:)
    qkinidrhataqinmlanklmlytqkfgigmtewriisvlssasdcsvqkisdilgldka
    avsrtvkkleekkyievyainltemgqelyevasdfaierekqlleefeeaekdqlfill
    kklrnkvdqm
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nrvC (C:)
    snamqkinidrhataqinmlanklmlksstaytqkfgigmtewriisvlssasdcsvqki
    sdilgldkaavsrtvkkleekkyievnghsedkrtyainltemgqelyevasdfaierek
    qlleefeeaekdqlfillkklrnkvdqm
    

    Sequence, based on observed residues (ATOM records):
    >3nrvC (C:)
    inidrhataqinmlanklmlksstaytqkfgigmtewriisvlssasdcsvqkisdilgl
    dkaavsrtvkkleekkyievnghsedkrtyainltemgqelyevasdfaierekqlleef
    eeaekdqlfillkklrnkvdqm
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nrvD (D:)
    snamqkinidrhataqinmlanklmlksstaytqkfgigmtewriisvlssasdcsvqki
    sdilgldkaavsrtvkkleekkyievnghsedkrtyainltemgqelyevasdfaierek
    qlleefeeaekdqlfillkklrnkvdqm
    

    Sequence, based on observed residues (ATOM records):
    >3nrvD (D:)
    inidrhataqinmlanklmlksstaytqkfgigmtewriisvlssasdcsvqkisdilgl
    dkaavsrtvkkleekkyievnghsedkrtyainltemgqelyevasdfaierekqlleef
    eeaekdqlfillkklrnkvdqm