PDB entry 3nru

View 3nru on RCSB PDB site
Description: Ligand binding domain of EPHA7
Class: transferase
Keywords: kinase, transferase
Deposited on 2010-06-30, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.237
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nrua_
  • Chain 'B':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nrub_
  • Chain 'C':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nruc1, d3nruc2
  • Chain 'D':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nrud1, d3nrud2
  • Chain 'E':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nrue1, d3nrue2
  • Chain 'F':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nruf1, d3nruf2
  • Chain 'G':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3nrug1, d3nrug2
  • Chain 'H':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nruh1, d3nruh2
  • Chain 'I':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nrui1, d3nrui2
  • Chain 'J':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nruj1, d3nruj2
  • Chain 'K':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZLK0 (2-174)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nruk1, d3nruk2
  • Chain 'L':
    Compound: Ephrin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nrul_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nruA (A:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruA (A:)
    evllldskaewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgnaq
    rifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidtiaadesft
    klntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nruB (B:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruB (B:)
    evllldskaqqewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgn
    aqrifvelkftlrdcnslpgvlcketfnlyyyetdydtgrnirenlyvkidtiaadesmk
    lntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nruC (C:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruC (C:)
    aevllldskaewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgna
    qrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidtiaadesk
    mklntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nruD (D:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruD (D:)
    aevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwi
    skgnaqrifvelkftlrdcnslpgvcketfnlyyyetdydtgrnirenlyvkidtiaade
    sklntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nruE (E:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruE (E:)
    aevllldskaqqewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskg
    naqrifvelkftlrdcnslpgvgtcketfnlyyyetdydtgrnirenlyvkidtiaades
    ftkmklntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nruF (F:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruF (F:)
    aevllldskaqqewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskg
    naqrifvelkftlrdcnslpgtcketfnlyyyetdydtgrnirenlyvkidtiaadekln
    tevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3nruG (G:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruG (G:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgtcketfnlyyyetdydtgrnirenlyvkidtiaad
    eklntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3nruH (H:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruH (H:)
    aevllldskaewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgna
    qrifvelkftlrdcnslvlgtcketfnlyyyetdydtgrnirenlyvkidtiaadesmkl
    ntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3nruI (I:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruI (I:)
    aevllldskaewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgna
    qrifvelkftlrdcnslpgvcketfnlyyyetdydtgrnirenlyvkidtiaadesftrk
    mklntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3nruJ (J:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruJ (J:)
    aevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwi
    skgnaqrifvelkftlrdcnslplgtcketfnlyyyetdydtgrnirenlyvkidtiaad
    esklntevreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3nruK (K:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruK (K:)
    aevllldskaqewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgn
    aqrifvelkftlrdcnslpgvcketfnlyyyetdydtgrnirenlyvkidtiaadeklnt
    evreigplskkgfylafqdvgacialvsvkvyykk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3nruL (L:)
    aaevllldskaqqtelewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnw
    iskgnaqrifvelkftlrdcnslpgvlgtcketfnlyyyetdydtgrnirenlyvkidti
    aadesftqgdlgerkmklntevreigplskkgfylafqdvgacialvsvkvyykkefveh
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nruL (L:)
    evllldskaewissppngweeisgldenytpirtyqvcqvmepnqnnwlrtnwiskgnaq
    rifvelkftlrdcnslpggtcketfnlyyyetddtirenlyvkidtiaadesftkmklnt
    evreigplskkgfylafqdvgacialvsvkvyy