PDB entry 3nrt

View 3nrt on RCSB PDB site
Description: The crystal strucutre of putative ryanodine receptor from Bacteroides thetaiotaomicron VPI-5482
Deposited on 2010-06-30, released 2010-09-15
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ryanodine receptor
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_2247
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative ryanodine receptor
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_2247
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative ryanodine receptor
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_2247
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Putative ryanodine receptor
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_2247
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Putative ryanodine receptor
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_2247
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Putative ryanodine receptor
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_2247
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrtA (A:)
    snamkenkldyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddi
    hkkhpclvpydelpeeekeydrntamntikmvkklgfrieked
    

    Sequence, based on observed residues (ATOM records):
    >3nrtA (A:)
    dyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddihkkhpclvp
    ydelpeeekeydrntamntikmvkklgfrieke
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nrtB (B:)
    snamkenkldyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddi
    hkkhpclvpydelpeeekeydrntamntikmvkklgfrieked
    

    Sequence, based on observed residues (ATOM records):
    >3nrtB (B:)
    dyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddihkkhpclvp
    ydelpeeekeydrntamntikmvkklgfrieked
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nrtC (C:)
    snamkenkldyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddi
    hkkhpclvpydelpeeekeydrntamntikmvkklgfrieked
    

    Sequence, based on observed residues (ATOM records):
    >3nrtC (C:)
    kenkldyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddihkkh
    pclvpydelpeeekeydrntamntikmvkklgfrieked
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nrtD (D:)
    snamkenkldyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddi
    hkkhpclvpydelpeeekeydrntamntikmvkklgfrieked
    

    Sequence, based on observed residues (ATOM records):
    >3nrtD (D:)
    dyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddihkkhpclvp
    ydelpeeekeydrntamntikmvkklgfrieke
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nrtE (E:)
    snamkenkldyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddi
    hkkhpclvpydelpeeekeydrntamntikmvkklgfrieked
    

    Sequence, based on observed residues (ATOM records):
    >3nrtE (E:)
    enkldyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddihkkhp
    clvpydelpeeekeydrntamntikmvkklgfrieked
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nrtF (F:)
    snamkenkldyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddi
    hkkhpclvpydelpeeekeydrntamntikmvkklgfrieked
    

    Sequence, based on observed residues (ATOM records):
    >3nrtF (F:)
    dyipepmdlslvdlpesliqlseriaenvhevwakaridegwtygekrddihkkhpclvp
    ydelpeeekeydrntamntikmvkklgfrieked