PDB entry 3nrq

View 3nrq on RCSB PDB site
Description: Crystal structure of copper-reconstituted FetP from uropathogenic Escherichia coli strain F11
Class: transport protein
Keywords: Immunoglobulin-like fold, Iron transporter, Copper binding, Transport Protein
Deposited on 2010-06-30, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic protein-probably involved in high-affinity Fe2+ transport
    Species: Escherichia coli [TaxId:340197]
    Gene: EcF11_1994
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nrqa_
  • Chain 'B':
    Compound: Periplasmic protein-probably involved in high-affinity Fe2+ transport
    Species: Escherichia coli [TaxId:340197]
    Gene: EcF11_1994
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nrqb_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nrqA (A:)
    mgfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfg
    agewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhiepps
    kagmhrhtdsetgvgrwwkpfdvsyefkyvglnssglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nrqA (A:)
    keypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfgage
    wipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppskag
    mhrhtdsetgvgrwwkpfdvsyefkyvgln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nrqB (B:)
    mgfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfg
    agewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhiepps
    kagmhrhtdsetgvgrwwkpfdvsyefkyvglnssglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nrqB (B:)
    keypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfgage
    wipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppskag
    mhrhtdsetgvgrwwkpfdvsyefkyvgl