PDB entry 3nrp

View 3nrp on RCSB PDB site
Description: Crystal structure of 'as isolated' uropathogenic E. coli strain F11 FetP recombinantly expressed in the periplasm of E. coli BL21(DE3)
Class: transport protein
Keywords: Immunoglobulin-like fold, Iron transporter, Copper binding, Transport Protein
Deposited on 2010-06-30, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic protein-probably involved in high-affinity Fe2+ transport
    Species: Escherichia coli [TaxId:340197]
    Gene: EcF11_1994
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3HWD5 (2-152)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nrpa1, d3nrpa2
  • Chain 'B':
    Compound: Periplasmic protein-probably involved in high-affinity Fe2+ transport
    Species: Escherichia coli [TaxId:340197]
    Gene: EcF11_1994
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3HWD5 (2-152)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nrpb1, d3nrpb2
  • Chain 'C':
    Compound: Periplasmic protein-probably involved in high-affinity Fe2+ transport
    Species: Escherichia coli [TaxId:340197]
    Gene: EcF11_1994
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3HWD5 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nrpc1, d3nrpc2
  • Chain 'D':
    Compound: Periplasmic protein-probably involved in high-affinity Fe2+ transport
    Species: Escherichia coli [TaxId:340197]
    Gene: EcF11_1994
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3HWD5 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3nrpd1, d3nrpd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nrpA (A:)
    mgfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfg
    agewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhiepps
    kagmhrhtdsetgvgrwwkpfdvsyefkyvglnssglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nrpA (A:)
    gfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfga
    gewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppsk
    agmhrhtdsetgvgrwwkpfdvsyefkyvgln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nrpB (B:)
    mgfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfg
    agewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhiepps
    kagmhrhtdsetgvgrwwkpfdvsyefkyvglnssglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nrpB (B:)
    gfkeypagepvtmnemelaavylqpidmeprgglpaakadvhleadihavegnkngfgag
    ewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppska
    gmhrhtdsetgvgrwwkpfdvsyefkyvgln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nrpC (C:)
    mgfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfg
    agewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhiepps
    kagmhrhtdsetgvgrwwkpfdvsyefkyvglnssglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nrpC (C:)
    gfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfga
    gewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppsk
    agmhrhtdsetgvgrwwkpfdvsyefkyvgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nrpD (D:)
    mgfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfg
    agewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhiepps
    kagmhrhtdsetgvgrwwkpfdvsyefkyvglnssglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nrpD (D:)
    gfkeypagepvtmnemelaavylqpidmeprgmglpaakadvhleadihavegnkngfga
    gewipyltisytlvnndtgekqegtfmpmvasdgphyganikmmgvgnykvtyhieppsk
    agmhrhtdsetgvgrwwkpfdvsyefkyvgl