PDB entry 3nro

View 3nro on RCSB PDB site
Description: crystal structure of putative transcriptional factor lmo1026 from listeria monocytogenes (fragment 52-321), northeast structural genomics consortium target lmr194
Deposited on 2010-06-30, released 2010-08-04
The last revision was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.235
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lmo1026 protein
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: lmo1026
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Lmo1026 protein
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: lmo1026
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nroA (A:)
    mkinvplessnktlsdlekkkpfsvllmgsdaragekngradtiilatankqqnavemvs
    iprdtkvdygngdigkinasysnggpsgtvsaveklmpgvpvdyfisinmegfkdlvdav
    ggitvyndidltevnskfvkgnitlngtealqyvrirhedprgdfgrqdrqrdviigian
    kvisssgvsnfesimkavgdnfqtnmtltditsmaanyssvlknvdsqelkgegemiyse
    sygfdlyyfapdktdleriitmfkkslditelehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nroA (A:)
    ekkkpfsvllmgsgradtiilatankqqnavemvsiprdtkvdygngdigkinasysngg
    psgtvsaveklmpgvpvdyfisinmegfkdlvdavggitvyndidltevnskfvkgnitl
    ngtealqyvrirhedprgdfgrqdrqrdviigiankvsimkavgdnfqtnmtltditsma
    anyssvlknvdsqelkgegemiysesygfdlyyfapdktdleriitmfkksldit
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nroB (B:)
    mkinvplessnktlsdlekkkpfsvllmgsdaragekngradtiilatankqqnavemvs
    iprdtkvdygngdigkinasysnggpsgtvsaveklmpgvpvdyfisinmegfkdlvdav
    ggitvyndidltevnskfvkgnitlngtealqyvrirhedprgdfgrqdrqrdviigian
    kvisssgvsnfesimkavgdnfqtnmtltditsmaanyssvlknvdsqelkgegemiyse
    sygfdlyyfapdktdleriitmfkkslditelehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nroB (B:)
    tlsdlekkkpfsvllmgsdradtiilatankqqnavemvsiprdtkvdigkinasysngg
    psgtvsaveklmpgvpvdyfisinmegfkdlvdavggitvyndidltevnskfvkgnitl
    ngtealqyvrirhedprgdfgrqdrqrdviigiankvissimkavgdnfqtnmtltdits
    maanyssvlknvdsqelkgegemiysesygfdlyyfapdktdleriitmfkksldit