PDB entry 3nrn

View 3nrn on RCSB PDB site
Description: Crystal Structure of PF1083 protein from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfR223
Deposited on 2010-06-30, released 2010-11-03
The last revision was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein PF1083
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF1083
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrnA (A:)
    mravvvgaglggllagaflarngheiivleksamiggrftnlpykgfqlstgalhmiphg
    edgplahllrilgakveivnsnpkgkilwegkifhyreswkflsvkekakalkllaeirm
    nklpkeeipadewikekigenefllsvlesfagwadsvslsdltalelakeiraalrwgg
    pglirggckavideleriimenkgkiltrkevveinieekkvytrdneeysfdvaisnvg
    vretvkligrdyfdrdylkqvdsiepsegikfnlavpgeprigntivftpglmingfnep
    saldkslaregytlimahmalkngnvkkaiekgweelleifpegepllaqvyrdgnpvnr
    traglhiewplnevlvvgdgyrppggievdgialgvmkaleklnlgsfsewyllehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >3nrnA (A:)
    mravvvgaglggllagaflarngheiivleksamiggrftnlpykgfqlstgalhmiphg
    edgplahllrilgakveivnsnpkgkilwegkifhyreswkflskllaeirmnklpkeei
    padewikekigenefllsvlesfagwadsvslsdltalelakeiraalrwggpglirggc
    kavideleriimenkgkiltrkevveinieekkvytrdneeysfdvaisnvgvretvkli
    grdyfdrdylkqvdsiepsegikfnlavpgeprigntivftpglmingfnepsaldksla
    regytlimahmalkngnvkkaiekgweelleifpegepllaqvyhiewplnevlvvgdgy
    rppggievdgialgvmkaleklnlgsfsewyl