PDB entry 3nrl

View 3nrl on RCSB PDB site
Description: Crystal Structure of protein RUMGNA_01417 from Ruminococcus gnavus, Northeast Structural Genomics Consortium Target UgR76
Deposited on 2010-06-30, released 2010-08-25
The last revision was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein RUMGNA_01417
    Species: Ruminococcus gnavus [TaxId:411470]
    Gene: RUMGNA_01417
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: uncharacterized protein RUMGNA_01417
    Species: Ruminococcus gnavus [TaxId:411470]
    Gene: RUMGNA_01417
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrlA (A:)
    msehregtlfydtetgrydirfdlesfygglhcgecfdvkvkdvwvpvriemgddwylvg
    lnvsrldglrvrmlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nrlA (A:)
    regtlfydtetgrydirfdlesfygglhcgecfdvkvkdvwvpvriemgddwylvglnvs
    rldglrvrm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nrlB (B:)
    msehregtlfydtetgrydirfdlesfygglhcgecfdvkvkdvwvpvriemgddwylvg
    lnvsrldglrvrmlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nrlB (B:)
    regtlfydtetgrydirfdlesfygglhcgecfdvkvkdvwvpvriemgddwylvglnvs
    rldglrvrm