PDB entry 3nrk

View 3nrk on RCSB PDB site
Description: The crystal structure of the leptospiral hypothetical protein LIC12922
Deposited on 2010-06-30, released 2010-11-24
The last revision was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lic12922
    Species: Leptospira interrogans serovar Copenhageni [TaxId:267671]
    Gene: LIC12922, LIC_12922
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrkA (A:)
    kagsaaapfteslnrviatvgtvsiseldlddatekynrlqkhlkhedyrksfrtriidf
    lidraivdvvaeeesiqvneqrvdseiekrmevmgitnrkqfektmetssgmpfelwvte
    lpyqikkgqllqlkiavpppneqeirswynqnkdkvgfeiryriisiapendsiqeenrl
    ykevseirksiladpssfaliagsprndpalrarrgmvewissfdlykyskitatiaapl
    pnggvsevfrderkrycilkiegkrptpmenlrggiqnilyrdkeedtfhrwlkesraei
    piqifdeayrkenkiplkeetfhld
    

    Sequence, based on observed residues (ATOM records):
    >3nrkA (A:)
    lnrviatvgtvsiseldlddatekynrlqkhlkhedyrksfrtriidflidraivdvvae
    eesiqvneqrvdseiekrmevmgitnrkqfektmetssgmpfelwvtelpyqikkgqllq
    lkiavpppneqeirswynqnkdkvgfeiryriisiapendsiqeenrlykevseirksil
    adpssfaliagsprndpalrarrgmvewissfdlykyskitatiaaplpnggvsevfrde
    rkrycilkiegkrptpmenlrggiqnilyrdkeedtfhrwlkesraeipiqifdeayrke
    nkiplkeetfhl