PDB entry 3nri

View 3nri on RCSB PDB site
Description: Crystal structure of the C(30) carotenoid dehydrosqualene synthase from S. aureus complexed with dehydrosqualene (DHS)
Deposited on 2010-06-30, released 2010-12-22
The last revision was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.211
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehydrosqualene synthase
    Species: Staphylococcus aureus [TaxId:585147]
    Gene: crtm, SHAG_00345
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DH7

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nriA (A:)
    aaaaaamtmmdmnfkychkimkkhsksfsyafdllpedqrkavwaiyavcrkiddsidvy
    gdiqflnqikediqsiekypyeyhhfqsdrrimmalqhvaqhkniafqsfynlidtvykd
    qhftmfetdaelfgycygvagtvgevltpilsdhethqtydvarrlgeslqlinilrdvg
    edfeneriyfskqrlkqyevdiaevyqngvnnhyidlweyyaaiaekdfrdvmdqikvfs
    ieaqpiielaariyieildevrqanytlhervfvekrkkaklfheinskyhri
    

    Sequence, based on observed residues (ATOM records):
    >3nriA (A:)
    mtmmdmnfkychkimkkhsksfsyafdllpedqrkavwaiyavcrkiddsiiqflnqike
    diqsiekypyeyhhfqsdrrimmalqhvaqhkniafqsfynlidtvykdqhftmfetdae
    lfgycygvagtvgevltpilsdhethqtydvarrlgeslqlinilrdvgedfeneriyfs
    kqrlkqyevdiaevyqngvnnhyidlweyyaaiaekdfrdvmdqikvfsieaqpiielaa
    riyieildevrqanytlhervfvekrkkaklfheinsky