PDB entry 3nrg

View 3nrg on RCSB PDB site
Description: crystal structure of a tetr family transcriptional regulator (caur_2714) from chloroflexus aurantiacus j-10-fl at 2.56 a resolution
Deposited on 2010-06-30, released 2010-09-22
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TetR family Transcriptional regulator
    Species: Chloroflexus aurantiacus [TaxId:324602]
    Gene: Caur_2714
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9WJL5 (1-216)
      • leader sequence (0)
  • Chain 'B':
    Compound: TetR family Transcriptional regulator
    Species: Chloroflexus aurantiacus [TaxId:324602]
    Gene: Caur_2714
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9WJL5 (1-216)
      • leader sequence (0)
  • Chain 'C':
    Compound: TetR family Transcriptional regulator
    Species: Chloroflexus aurantiacus [TaxId:324602]
    Gene: Caur_2714
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9WJL5 (1-216)
      • leader sequence (0)
  • Chain 'D':
    Compound: TetR family Transcriptional regulator
    Species: Chloroflexus aurantiacus [TaxId:324602]
    Gene: Caur_2714
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9WJL5 (1-216)
      • leader sequence (0)
  • Chain 'E':
    Compound: TetR family Transcriptional regulator
    Species: Chloroflexus aurantiacus [TaxId:324602]
    Gene: Caur_2714
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9WJL5 (1-216)
      • leader sequence (0)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nrgA (A:)
    gmptetffnlpeekrsrlidvlldefaqndydsvsinriteragiakgsfyqyfadkkdc
    ylyliqlgieqktaflrqtppasttdmfaylrwlldvgiqfqfhnprlaqiaykalyddv
    plpaetmqvirhgsfayfkqlveqgiadgslvpdldadtaafvlnvvftelgnhlierfa
    vnpaellreggivllqpamrrvieqvidilergmrrr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nrgB (B:)
    gmptetffnlpeekrsrlidvlldefaqndydsvsinriteragiakgsfyqyfadkkdc
    ylyliqlgieqktaflrqtppasttdmfaylrwlldvgiqfqfhnprlaqiaykalyddv
    plpaetmqvirhgsfayfkqlveqgiadgslvpdldadtaafvlnvvftelgnhlierfa
    vnpaellreggivllqpamrrvieqvidilergmrrr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3nrgC (C:)
    gmptetffnlpeekrsrlidvlldefaqndydsvsinriteragiakgsfyqyfadkkdc
    ylyliqlgieqktaflrqtppasttdmfaylrwlldvgiqfqfhnprlaqiaykalyddv
    plpaetmqvirhgsfayfkqlveqgiadgslvpdldadtaafvlnvvftelgnhlierfa
    vnpaellreggivllqpamrrvieqvidilergmrrr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3nrgD (D:)
    gmptetffnlpeekrsrlidvlldefaqndydsvsinriteragiakgsfyqyfadkkdc
    ylyliqlgieqktaflrqtppasttdmfaylrwlldvgiqfqfhnprlaqiaykalyddv
    plpaetmqvirhgsfayfkqlveqgiadgslvpdldadtaafvlnvvftelgnhlierfa
    vnpaellreggivllqpamrrvieqvidilergmrrr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3nrgE (E:)
    gmptetffnlpeekrsrlidvlldefaqndydsvsinriteragiakgsfyqyfadkkdc
    ylyliqlgieqktaflrqtppasttdmfaylrwlldvgiqfqfhnprlaqiaykalyddv
    plpaetmqvirhgsfayfkqlveqgiadgslvpdldadtaafvlnvvftelgnhlierfa
    vnpaellreggivllqpamrrvieqvidilergmrrr