PDB entry 3nrf

View 3nrf on RCSB PDB site
Description: crystal structure of an apag protein (pa1934) from pseudomonas aeruginosa pao1 at 1.50 a resolution
Deposited on 2010-06-30, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apaG protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA1934
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: apaG protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA1934
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MRD, CAC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrfA (A:)
    gaapdavmvfarqgdkgsvsvgdkhfrtqafkvrlvnaakseislknsclvaqsaagqsf
    rldtvdeeltadtlkpgasvegdaifaseddavygaslvrlsdrck
    

    Sequence, based on observed residues (ATOM records):
    >3nrfA (A:)
    davmvfarqgdkgsvsvgdkhfrtqafkvrlvnaakseislknsclvaqsaagqsfrldt
    vdeeltadtlkpgasvegdaifaseddavygaslvrlsdrck
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nrfB (B:)
    gaapdavmvfarqgdkgsvsvgdkhfrtqafkvrlvnaakseislknsclvaqsaagqsf
    rldtvdeeltadtlkpgasvegdaifaseddavygaslvrlsdrck
    

    Sequence, based on observed residues (ATOM records):
    >3nrfB (B:)
    apdavmvfarqgdkgsvsvgdkhfrtqafkvrlvnaakseislknsclvaqsaagqsfrl
    dtvdeeltadtlkpgasvegdaifaseddavygaslvrlsdrc