PDB entry 3nre

View 3nre on RCSB PDB site
Description: crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution
Deposited on 2010-06-30, released 2010-09-15
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose 1-epimerase
    Species: Escherichia coli [TaxId:83333]
    Gene: EcDH1_1124
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9QPM9 (1-290)
      • leader sequence (0)
  • Chain 'B':
    Compound: aldose 1-epimerase
    Species: Escherichia coli [TaxId:83333]
    Gene: EcDH1_1124
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9QPM9 (1-290)
      • leader sequence (0)
  • Chain 'C':
    Compound: aldose 1-epimerase
    Species: Escherichia coli [TaxId:83333]
    Gene: EcDH1_1124
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9QPM9 (1-290)
      • leader sequence (0)
  • Chain 'D':
    Compound: aldose 1-epimerase
    Species: Escherichia coli [TaxId:83333]
    Gene: EcDH1_1124
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9QPM9 (1-290)
      • leader sequence (0)
  • Heterogens: PEG, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nreA (A:)
    gmtiytlshgslkldvsdqggviegfwrdttpllrpgkksgvatdascfplvpfanrvsg
    nrfvwqgreyqlqpnvewdahylhgdgwlgewqcvshsddslclvyehrsgvyhyrvsqa
    fhltadtltvtlsvtnqgaetlpfgtgwhpyfplspqtriqaqasgywlereqwlagefc
    eqlpqeldfnqpaplprqwvnngfagwngqarieqpqegyaiimettppapcyfifvsdp
    afdkgyafdffclepmshapddhhrpeggdlialapgesttsemslrvewl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nreB (B:)
    gmtiytlshgslkldvsdqggviegfwrdttpllrpgkksgvatdascfplvpfanrvsg
    nrfvwqgreyqlqpnvewdahylhgdgwlgewqcvshsddslclvyehrsgvyhyrvsqa
    fhltadtltvtlsvtnqgaetlpfgtgwhpyfplspqtriqaqasgywlereqwlagefc
    eqlpqeldfnqpaplprqwvnngfagwngqarieqpqegyaiimettppapcyfifvsdp
    afdkgyafdffclepmshapddhhrpeggdlialapgesttsemslrvewl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3nreC (C:)
    gmtiytlshgslkldvsdqggviegfwrdttpllrpgkksgvatdascfplvpfanrvsg
    nrfvwqgreyqlqpnvewdahylhgdgwlgewqcvshsddslclvyehrsgvyhyrvsqa
    fhltadtltvtlsvtnqgaetlpfgtgwhpyfplspqtriqaqasgywlereqwlagefc
    eqlpqeldfnqpaplprqwvnngfagwngqarieqpqegyaiimettppapcyfifvsdp
    afdkgyafdffclepmshapddhhrpeggdlialapgesttsemslrvewl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3nreD (D:)
    gmtiytlshgslkldvsdqggviegfwrdttpllrpgkksgvatdascfplvpfanrvsg
    nrfvwqgreyqlqpnvewdahylhgdgwlgewqcvshsddslclvyehrsgvyhyrvsqa
    fhltadtltvtlsvtnqgaetlpfgtgwhpyfplspqtriqaqasgywlereqwlagefc
    eqlpqeldfnqpaplprqwvnngfagwngqarieqpqegyaiimettppapcyfifvsdp
    afdkgyafdffclepmshapddhhrpeggdlialapgesttsemslrvewl