PDB entry 3nrd

View 3nrd on RCSB PDB site
Description: crystal structure of a histidine triad (hit) protein (smc02904) from sinorhizobium meliloti 1021 at 2.06 a resolution
Deposited on 2010-06-30, released 2010-07-28
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine triad (HIT) protein
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R00229, SMc02904
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92KT3 (1-134)
      • leader sequence (0)
  • Chain 'B':
    Compound: Histidine triad (HIT) protein
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R00229, SMc02904
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Histidine triad (HIT) protein
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R00229, SMc02904
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Histidine triad (HIT) protein
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R00229, SMc02904
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92KT3 (1-134)
      • leader sequence (0)
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nrdA (A:)
    gmttftlderlerdgipigtlglcqmrlmndrrwpwlilvpqradikevfeltpldqaml
    tfetnlvaaglkkatgaekinigalgnivrqlhvhviarregdpnwpgpvwgfgkaepwp
    eeehrtfaarimenl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nrdB (B:)
    gmttftlderlerdgipigtlglcqmrlmndrrwpwlilvpqradikevfeltpldqaml
    tfetnlvaaglkkatgaekinigalgnivrqlhvhviarregdpnwpgpvwgfgkaepwp
    eeehrtfaarimenl
    

    Sequence, based on observed residues (ATOM records):
    >3nrdB (B:)
    mttftlderlerdgipigtlglcqmrlmndrrwpwlilvpqradikevfeltpldqamlt
    fetnlvaaglkkatgaekinigalgnivrqlhvhviarregdpnwpgpvwgfgkaepwpe
    eehrtfaarimenl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nrdC (C:)
    gmttftlderlerdgipigtlglcqmrlmndrrwpwlilvpqradikevfeltpldqaml
    tfetnlvaaglkkatgaekinigalgnivrqlhvhviarregdpnwpgpvwgfgkaepwp
    eeehrtfaarimenl
    

    Sequence, based on observed residues (ATOM records):
    >3nrdC (C:)
    mttftlderlerdgipigtlglcqmrlmndrrwpwlilvpqradikevfeltpldqamlt
    fetnlvaaglkkatgaekinigalgnivrqlhvhviarregdpnwpgpvwgfgkaepwpe
    eehrtfaarimenl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3nrdD (D:)
    gmttftlderlerdgipigtlglcqmrlmndrrwpwlilvpqradikevfeltpldqaml
    tfetnlvaaglkkatgaekinigalgnivrqlhvhviarregdpnwpgpvwgfgkaepwp
    eeehrtfaarimenl