PDB entry 3nrc

View 3nrc on RCSB PDB site
Description: crystal structure of the francisella tularensis enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Deposited on 2010-06-30, released 2010-11-10
The last revision was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase (NADH)
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: fabI, fabI gene, FTT_0782
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase (NADH)
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: fabI, fabI gene, FTT_0782
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, TCL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrcA (A:)
    mgsshhhhhhssglvprgshmgflagkkilitgllsnksiaygiakamhregaelaftyv
    gqfkdrveklcaefnpaavlpcdvisdqeikdlfvelgkvwdgldaivhsiafaprdqle
    gnfidcvtregfsiahdisaysfaalakegrsmmknrnasmvaltyigaekampsyntmg
    vakasleatvrytalalgedgikvnavsagpiktlaasgisnfkkmldynamvsplkknv
    dimevgntvaflcsdmatgitgevvhvdagyhcvsmgnvl
    

    Sequence, based on observed residues (ATOM records):
    >3nrcA (A:)
    gflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavlp
    cdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisay
    sfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalgedg
    ikvnavsagpiktlaasgisnfkkmldynamvsplkknvdimevgntvaflcsdmatgit
    gevvhvdagyhcvsmg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nrcB (B:)
    mgsshhhhhhssglvprgshmgflagkkilitgllsnksiaygiakamhregaelaftyv
    gqfkdrveklcaefnpaavlpcdvisdqeikdlfvelgkvwdgldaivhsiafaprdqle
    gnfidcvtregfsiahdisaysfaalakegrsmmknrnasmvaltyigaekampsyntmg
    vakasleatvrytalalgedgikvnavsagpiktlaasgisnfkkmldynamvsplkknv
    dimevgntvaflcsdmatgitgevvhvdagyhcvsmgnvl
    

    Sequence, based on observed residues (ATOM records):
    >3nrcB (B:)
    gflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavlp
    cdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisay
    sfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalgedg
    ikvnavsagpiktlaasgisnfkkmldynamvsplkknvdimevgntvaflcsdmatgit
    gevvhvdagyhcvsmg