PDB entry 3nrb

View 3nrb on RCSB PDB site
Description: crystal structure of a formyltetrahydrofolate deformylase (puru, pp_1943) from pseudomonas putida kt2440 at 2.05 a resolution
Deposited on 2010-06-30, released 2010-07-28
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formyltetrahydrofolate deformylase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: purU-3, PP1943, PP_1943
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Formyltetrahydrofolate deformylase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: purU-3, PP1943, PP_1943
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Formyltetrahydrofolate deformylase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: purU-3, PP1943, PP_1943
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Formyltetrahydrofolate deformylase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: purU-3, PP1943, PP_1943
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, UNL, FLC, EDO, IMD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nrbA (A:)
    gmnknnqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipva
    gvndfnsafgkvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvg
    iisnhprealsvslvgdipfhylpvtpatkaaqesqiknivtqsqadlivlarymqilsd
    dlsaflsgrcinihhsflpgfkgakpyhqahtrgvkligatahfvtadldegpiiaqdve
    hvshrdsaedlvrkgrdierrvlsravllfledrlivngertvvfad
    

    Sequence, based on observed residues (ATOM records):
    >3nrbA (A:)
    knnqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipvndfn
    safgkvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvgiisnhp
    realsvslvgdipfhylpvtpatkaaqesqiknivtqsqadlivlarymqilsddlsafl
    sgrcinihhsflpgfkgakpyhqahtrgvkligatahfvtadldegpiiaqdvehvshrd
    saedlvrkgrdierrvlsravllfledrlivngertvvfad
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nrbB (B:)
    gmnknnqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipva
    gvndfnsafgkvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvg
    iisnhprealsvslvgdipfhylpvtpatkaaqesqiknivtqsqadlivlarymqilsd
    dlsaflsgrcinihhsflpgfkgakpyhqahtrgvkligatahfvtadldegpiiaqdve
    hvshrdsaedlvrkgrdierrvlsravllfledrlivngertvvfad
    

    Sequence, based on observed residues (ATOM records):
    >3nrbB (B:)
    nqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipvagvndf
    nsafgkvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvgiisnh
    prealsvslvgdipfhylpvtpatkaaqesqiknivtqsqadlivlarymqilsddlsaf
    lsgrcinihhsflpgfkgakpyhqahtrgvkligatahfvtadlgpiiaqdvehvshrds
    aedlvrkgrdierrvlsravllfledrlivngertvvfad
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nrbC (C:)
    gmnknnqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipva
    gvndfnsafgkvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvg
    iisnhprealsvslvgdipfhylpvtpatkaaqesqiknivtqsqadlivlarymqilsd
    dlsaflsgrcinihhsflpgfkgakpyhqahtrgvkligatahfvtadldegpiiaqdve
    hvshrdsaedlvrkgrdierrvlsravllfledrlivngertvvfad
    

    Sequence, based on observed residues (ATOM records):
    >3nrbC (C:)
    nnqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipvagvnd
    fnsafgkvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvgiisn
    hprealsvslvgdipfhylpvtpatkaaqesqiknivtqsqadlivlarymqilsddlsa
    flsgrcinihhsflpgfkgakpyhqahtrgvkligatahfvtaldegpiiaqdvehvshr
    dsaedlvrkgrdierrvlsravllfledrlivngertvvfad
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nrbD (D:)
    gmnknnqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipva
    gvndfnsafgkvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvg
    iisnhprealsvslvgdipfhylpvtpatkaaqesqiknivtqsqadlivlarymqilsd
    dlsaflsgrcinihhsflpgfkgakpyhqahtrgvkligatahfvtadldegpiiaqdve
    hvshrdsaedlvrkgrdierrvlsravllfledrlivngertvvfad
    

    Sequence, based on observed residues (ATOM records):
    >3nrbD (D:)
    nnqyvlslacqdapgivsevstflfnnganiveaeqfndedsskffmrvsveipvagvnd
    fnsafgkvvekynaewwfrprtdrkkvvimvskfdhclgdllyrhrlgeldmevvgiisn
    hprealsvslvgdipfhylpvtpatkaaqesqiknivtqsqadlivlarymqilsddlsa
    flsgrcinihhsflpgfkgakpyhqahtrgvkligatahfvtadldegpiiaqdvehvsh
    rdsaedlvrkgrdierrvlsravllfledrlivngertvvfad